PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G087300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 200aa    MW: 22373.8 Da    PI: 6.8528
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G087300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.72e-3171241128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGf+F P+deelvv++L++k++  +++  ++++++  ++++Pw+L+ k+ +  ++wyfFs++ +     +r++r   +g W+  g d++
  Brast09G087300.1.p   7 LPPGFHFFPSDEELVVHFLRRKASLLPCRP-DIVPTLPPNRYDPWELNGKALEAGNQWYFFSHSTQ-----SRTSR---NGQWNPIGADEA 88 
                         79*************************999.89**************966667789******9755.....35555...799********* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v s +g+++glkk ++f  g+  +++kt+Wvmhey+l
  Brast09G087300.1.p  89 VSS-GGRNIGLKKKFIFSIGEPFQSNKTNWVMHEYHL 124
                         **9.99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-434162IPR003441NAC domain
PROSITE profilePS5100539.697163IPR003441NAC domain
PfamPF023657.6E-218124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGGASNLPPG FHFFPSDEEL VVHFLRRKAS LLPCRPDIVP TLPPNRYDPW ELNGKALEAG  60
NQWYFFSHST QSRTSRNGQW NPIGADEAVS SGGRNIGLKK KFIFSIGEPF QSNKTNWVMH  120
EYHLHDGNGG SSTSSSSGKR SHKKKGHSNK ESSNWVICRV FESSCHSQVS FHEDDMELSC  180
LDEVFLSLDD YDEVSLPKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-31616819173NAC domain-containing protein 19
3swp_C3e-31616819173NAC domain-containing protein 19
3swp_B3e-31616819173NAC domain-containing protein 19
3swp_A3e-31616819173NAC domain-containing protein 19
3swm_D3e-31616819173NAC domain-containing protein 19
3swm_C3e-31616819173NAC domain-containing protein 19
3swm_B3e-31616819173NAC domain-containing protein 19
3swm_A3e-31616819173NAC domain-containing protein 19
4dul_B3e-31616816170NAC domain-containing protein 19
4dul_A3e-31616816170NAC domain-containing protein 19
1ut7_B3e-31616816170NO APICAL MERISTEM PROTEIN
1ut7_A3e-31616816170NO APICAL MERISTEM PROTEIN
1ut4_B3e-31616816170NO APICAL MERISTEM PROTEIN
1ut4_A3e-31616816170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579793.11e-145PREDICTED: NAC transcription factor NAM-1
SwissprotQ8GWK68e-63NC104_ARATH; NAC domain-containing protein 104
TrEMBLI1IXY01e-145I1IXY0_BRADI; Uncharacterized protein
STRINGBRADI5G10640.11e-145(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.14e-62xylem NAC domain 1